PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000691.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 198aa    MW: 22458.6 Da    PI: 9.8032
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000691.1_g00017.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR141.44.8e-1357129277
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwe 77 
                              fY eYA ++GF +r+ +s+ks+r+g+i++r + C   g ++++k   + +  +r   r gC a++ +k+ek g+w+
  Itr_sc000691.1_g00017.1  57 FYVEYAGRAGFITRVLSSRKSERDGSIISRGLGCR--GIPDTQKIG-NAATVKRDRRREGCAAMILIKREKPGTWV 129
                              9*********************************7..555555555.5688899999**************99995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-1057129IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MRRFVLFLLL DVQIAVDDSI ERVEFSAGGE VSPSETNRIR EPNEGMTFDS EAAARAFYVE  60
YAGRAGFITR VLSSRKSERD GSIISRGLGC RGIPDTQKIG NAATVKRDRR REGCAAMILI  120
KREKPGTWVD EKDKKIQELT AELRVKKRLS AAYREHLLGI MKDVESHSEH LSSKVQAIRE  180
NLRSLDAERQ ELLTRERP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605654.11e-90PREDICTED: protein FAR1-RELATED SEQUENCE 2-like isoform X1
TrEMBLM1CKJ46e-88M1CKJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000694932e-87(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.16e-39FAR1 family protein